PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.H01337.1.p
Common NameEUGRSUZ_H01337, LOC104456904
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 440aa    MW: 48797.4 Da    PI: 7.7071
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.H01337.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.72.4e-171461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g W++eEde+l+++++ +G g+W+++++  g+ R++k+c++rw +yl
  Eucgr.H01337.1.p 14 KGLWSPEEDEKLLNYITTYGHGCWSAVPKLAGLQRCGKSCRLRWINYL 61
                      678*******************************************97 PP

2Myb_DNA-binding47.63.9e-1567110146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       rg+++ +E+ l++++++ lG++ W+ Ia++++ gRt++++k++w++
  Eucgr.H01337.1.p  67 RGAFSHQEENLIIELHAVLGNR-WSQIAARLP-GRTDNEIKNFWNS 110
                       89********************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.0E-26664IPR009057Homeodomain-like
PROSITE profilePS5129417.628961IPR017930Myb domain
SuperFamilySSF466896.6E-2912108IPR009057Homeodomain-like
SMARTSM007175.4E-131363IPR001005SANT/Myb domain
PfamPF002492.8E-151461IPR001005SANT/Myb domain
CDDcd001671.14E-111761No hitNo description
PROSITE profilePS5129425.42862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.9E-2565116IPR009057Homeodomain-like
SMARTSM007174.8E-1566114IPR001005SANT/Myb domain
PfamPF002493.1E-1467110IPR001005SANT/Myb domain
CDDcd001671.18E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 440 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLLNYIT TYGHGCWSAV PKLAGLQRCG KSCRLRWINY  60
LRPDLKRGAF SHQEENLIIE LHAVLGNRWS QIAARLPGRT DNEIKNFWNS SLKKKLRQGG  120
IDPTTHKPLS EVADENDHKD KDKPIIPSIT QHNNNDHHHQ KSSSTAASCK KATLFEPALN  180
TDNLKVHHQQ HSLEVPASSE MRPYSEMFMK DFTFQQLSMN YGTSLGLPAS LHLSSNTLCF  240
DPRSSSENIM SQFSSDMSTP NIISPTMSSS STAVPVTSAR VKPSISLPAE AAFMVNNGVP  300
SWEASPGNNN CSSGSTNGNG LVSNNSSINN TAFFESNNCF SWGLGEGTNA SKFEKHVPFH  360
HPIGSNTTEE NSSKWSEYLQ LPILFGSLTQ NNDEASHHHQ PVSHFHLMDG LNNIPSWQQK  420
HHQQANPDTF AAPVLGQTL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-28121165108B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1111117LKKKLRQ
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.H01337.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010070106.10.0PREDICTED: transcription factor MYB86-like
TrEMBLA0A059AY600.0A0A059AY60_EUCGR; Uncharacterized protein
STRINGPOPTR_0013s00290.11e-106(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09540.11e-87myb domain protein 61